Advanced Problem Set 1

These problems will require thought.  You will need to use many applications at once.  Use the links and their instructions from the Applications section to help answer the following questions.  Many applications may need to be used at one time.  Hint:  Keep all results from the applications open until problem set is complete, you will most likely need them more than once.

 

 

  1. What is the common taxonomic branch between a) humans and a frog, b) a rat and a mouse, c) a chicken and a nematode worm, d)human and a rat, and e) fruit fly and chicken, f) bakers yeast and humans.

 

From your personal knowledge or by looking up at various sites (using Entrez works well), you should know the following names.

Homo sapien: human, Xenopus laervis: African frog, Rattus: rat, Mus musculus: mouse, Caenorhabididis elegans: nematode worm, Gallus gallus: chicken, Drosophila: fruit fly, Saccharomyces cerevisiea: bakers’ yeast.

 

Use taxonomy link from NCBI pages to get link between the different organisms.

a)Humans and frog: tetrapoda,  b) rat and mouse: murinae, c) chicken and nematode worm: bilateria, d) human and rat: Eutheria, e) fruit fly and chicken: deuterostomia, f) humans and yeast: eukaryotes.

 

 

 

  1. What is the source of this protein?  What is its function? What is the human homolog? What common disease is this protein thought to be involved in (give very specific examples)?

 

qrdcwmcntnmsvstegaastslqiapaseqetlvrpkplllkllksvgaaqndtytmkeiifyigqyimtkrlydekqqhivycsndllgdvfg

vpsfsvkehrkiymtamiyrnlvavsqqdsgvslsesrrqveggsdlkdplqappeekpsssdlisrlstssrrrsiseteentdelpgerhrk

rrrslsfdpslglcelremcsggtsssestetpshqdlddgvsehsgdcldqdsvsdqfsvefeversldsedyslsdeghelsdeddevyr

vtvyqiigesdtvtvdsfegdteisladywkctscnemnpplpshckrcwtlrenwipddkgkdkveisekakfensaqaeegldvpdgkkl

tendakepcaeedseekaeqtplsqesddysqpstsssivyslsqesvkelkeetqhkdesvessfslnaiepcvicqgrpkngcathgk

tghlmscftcakklimkkrnkpipcpipvcrqpiqmivlsyfn

 

Use blastp, and then other NCBI programs (OMIM, Entrez)

Source: Mus musculus

Protein: mdm2 Mouse double minute 2 gene)

Function: inhibit growth or invasion of cells (tumor suppressor)

Human Homolog: p53-associated protein, tumor suppressor gene

Disease:  lung, colon, breast, brain, skin, bladder, cervical cancers

 

This site is funded by the National Science Foundation .