Advanced Problem Set 1

These problems will require thought. You will need to use many applications at once. Use the links and their instructions from the Applications section to help answer the following questions. Many applications may need to be used at one time. Hint: Keep all results from the applications open until problem set is complete, you will most likely need them more than once.

1. What is the common taxonomic branch between a) humans and a frog, b) a rat and a mouse, c) a chicken and a nematode worm, d)human and a rat, and e) fruit fly and chicken, f) bakers yeast and humans.

2. What is the source of this protein? What is its function? What is the human homolog? What common disease is this protein thought to be involved in (give very specific examples)?

qrdcwmcntnmsvstegaastslqiapaseqetlvrpkplllkllksvgaaqndtytmkeiifyigqyimtkrlydekqqhivycsndllgdvfgvpsfsvkehrkiy mtamiyrnlvavsqqdsgvslsesrrqveggsdlkdplqappeekpsssdlisrlstssrrrsiseteentdelpgerhrkrrrslsfdpslglcelremcs ggtsssestetpshqdlddgvsehsgdcldqdsvsdqfsvefeversldsedyslsdeghelsdeddevyrvtvyqiigesdtvtvdsfegdteislady wkctscnemnpplpshckrcwtlrenwipddkgkdkveisekakfensaqaeegldvpdgkkltendakepcaeedseekaeqtplsqesddysqpstss sivyslsqesvkelkeetqhkdesvessfslnaiepcvicqgrpkngcathgktghlmscftcakklimkkrnkpipcpipvcrqpiqmivlsyfn

This site is funded by the National Science Foundation .